(data stored in ACNUC29543 zone)

EMBL: CP000521.PE371

CP000521.PE371       Location/Qualifiers
FT   CDS             421968..422348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10848"
FT                   /db_xref="GOA:A3M1Q4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Q4"
FT                   /protein_id="ABO10848.2"
FT                   /translation="MYYPLLSIALGSVLGAWLRWFLGLKLNPIYPQIPLGTVTVNLVGG
FT                   FIIGFAMAYFAHSDLSPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAISI
FT                   HLIGSLIFTCLGLAAYYWVAGH"
     MYYPLLSIAL GSVLGAWLRW FLGLKLNPIY PQIPLGTVTV NLVGGFIIGF AMAYFAHSDL        60
     SPNYKLFVIT GFCGALTTFS TFSIEIVTLL QSGKWGMAML AISIHLIGSL IFTCLGLAAY       120
     YWVAGH                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page