(data stored in ACNUC29543 zone)

EMBL: CP000521.PE374

CP000521.PE374       Location/Qualifiers
FT   CDS             complement(423792..425090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0392"
FT                   /product="putative ABC1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10851"
FT                   /protein_id="ABO10851.2"
FT                   /translation="MAKNASSPGKRFMKLAGMTASIATKTVSNSIRNLTADEEQKLAAK
FT                   TKLFQDIGLQIADTLGEMKGAVMKVGQIASQYKDIFPPEVAKAISKLQRQAPAMPFAAI
FT                   QQQVERELGKPLNVAFKSFEQEPFAAASIGQVHKAVLPSGEQVVVKVQYPGVDEACESD
FT                   LKQVRLALRLMGVLKIDKKLQDQLFAEIQDSLSAELNYEIEAQNLEVFKTFHSKLDDKI
FT                   IIPTVYKDYSSRRILTLSLEQGDSIETASSWPIEIRNTIGRRLIRALGQEMFFLKRFHC
FT                   DPHPGNFAFRQDGSVIIYDYGSVKTLSNEIVYSFKRLVNAARHEDIDLIETELLELHSL
FT                   AEKGKFPSDLYKLWIEVLLRPLTTTYDFAENSSHHDGMLLVKKSLKYWDVFKPSPDTLM
FT                   VNRTISGHYWNLIHLKVHDNLNDLFEELVPLSN"
     MAKNASSPGK RFMKLAGMTA SIATKTVSNS IRNLTADEEQ KLAAKTKLFQ DIGLQIADTL        60
     GEMKGAVMKV GQIASQYKDI FPPEVAKAIS KLQRQAPAMP FAAIQQQVER ELGKPLNVAF       120
     KSFEQEPFAA ASIGQVHKAV LPSGEQVVVK VQYPGVDEAC ESDLKQVRLA LRLMGVLKID       180
     KKLQDQLFAE IQDSLSAELN YEIEAQNLEV FKTFHSKLDD KIIIPTVYKD YSSRRILTLS       240
     LEQGDSIETA SSWPIEIRNT IGRRLIRALG QEMFFLKRFH CDPHPGNFAF RQDGSVIIYD       300
     YGSVKTLSNE IVYSFKRLVN AARHEDIDLI ETELLELHSL AEKGKFPSDL YKLWIEVLLR       360
     PLTTTYDFAE NSSHHDGMLL VKKSLKYWDV FKPSPDTLMV NRTISGHYWN LIHLKVHDNL       420
     NDLFEELVPL SN                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page