(data stored in ACNUC29543 zone)

EMBL: CP000521.PE378

CP000521.PE378       Location/Qualifiers
FT   CDS             complement(429293..429691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0396"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10855"
FT                   /protein_id="ABO10855.2"
FT                   /translation="MAFQTAINAQLREQLHSPLQAALLSFFIGTIVLAIMVFFQSAEKP
FT                   SLSEISNIPWLLWTGGFLGVYAISMSIYTAPKLGFLTFTGLVVFGQLVISMLLDHFGWL
FT                   GTEKTPVTWQRFLGGVVIFVGVLLTLQR"
     MAFQTAINAQ LREQLHSPLQ AALLSFFIGT IVLAIMVFFQ SAEKPSLSEI SNIPWLLWTG        60
     GFLGVYAISM SIYTAPKLGF LTFTGLVVFG QLVISMLLDH FGWLGTEKTP VTWQRFLGGV       120
     VIFVGVLLTL QR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page