(data stored in ACNUC29543 zone)

EMBL: CP000521.PE384

CP000521.PE384       Location/Qualifiers
FT   CDS             440328..441002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0406"
FT                   /product="putative phosphoglycolate phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10861"
FT                   /protein_id="ABO10861.2"
FT                   /translation="MSLKTELVIFDWDGTLYNSVGQIVASLQHAAEEHKLTLTDEAAKS
FT                   IIGLGLPEVMQTLFPEVPDLHDSILKAYGDHYIANSTNDAWFEGISELLHDLKAQGLKL
FT                   AVATGKNRRGLDRVIAKTQSTHLFDVTRAANETRSKPDPLMLQEILTVTGVSVEQAVMI
FT                   GDSSYDLEMAQRLGMPRIGVGYGVHSVEVLQQFQPLTIAKDVPELHNFLREYAKLSTVD
FT                   VA"
     MSLKTELVIF DWDGTLYNSV GQIVASLQHA AEEHKLTLTD EAAKSIIGLG LPEVMQTLFP        60
     EVPDLHDSIL KAYGDHYIAN STNDAWFEGI SELLHDLKAQ GLKLAVATGK NRRGLDRVIA       120
     KTQSTHLFDV TRAANETRSK PDPLMLQEIL TVTGVSVEQA VMIGDSSYDL EMAQRLGMPR       180
     IGVGYGVHSV EVLQQFQPLT IAKDVPELHN FLREYAKLST VDVA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page