(data stored in ACNUC29543 zone)

EMBL: CP000521.PE387

CP000521.PE387       Location/Qualifiers
FT   CDS             complement(442486..443163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0409"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10864"
FT                   /protein_id="ABO10864.2"
FT                   /translation="MVGLFQHLGRSVQNRPHFFIALIFGVVVASLLAWLTSWKWSTILL
FT                   ASWNGSISLYLLHVWKLMRSADHSQMQQQAKKQDESKWVIMLIVLLAITMSLVAILVQL
FT                   SQLPSGHYEKLGHVALALLTIISAWLFMHTVFALHYAHDFYMALSRNEENGGLDFPGTE
FT                   HPTYPDFLYFSYIIGTSAQTADVSITNKHMRLLNLFHAVLSFGFNTTILAICINVAAGF
FT                   LTN"
     MVGLFQHLGR SVQNRPHFFI ALIFGVVVAS LLAWLTSWKW STILLASWNG SISLYLLHVW        60
     KLMRSADHSQ MQQQAKKQDE SKWVIMLIVL LAITMSLVAI LVQLSQLPSG HYEKLGHVAL       120
     ALLTIISAWL FMHTVFALHY AHDFYMALSR NEENGGLDFP GTEHPTYPDF LYFSYIIGTS       180
     AQTADVSITN KHMRLLNLFH AVLSFGFNTT ILAICINVAA GFLTN                       225
//

If you have problems or comments...

PBIL Back to PBIL home page