(data stored in ACNUC29543 zone)

EMBL: CP000521.PE395

CP000521.PE395       Location/Qualifiers
FT   CDS             454027..455445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0417"
FT                   /product="3-isopropylmalate dehydratase (isomerase) subunit
FT                   with LeuD"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10872"
FT                   /db_xref="GOA:A3M1S8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1S8"
FT                   /protein_id="ABO10872.2"
FT                   /translation="MAGKTLYDKLWDDHVVTQRDDGSCLLYIDRHLLHEVTSPQAFEGL
FT                   QLAGRQPWRLSANVATPDHNVPTSKKERDQGIAGIEDDTSRIQVQTLDDNCKAFNIVEF
FT                   GINDIRQGIVHVVGPEQGLTLPGMTVVCGDSHTATHGAFGCLAHGIGTSEVEHVLATQC
FT                   LVQKKSKNMLVRVDGVLGKGVTPKDVVLAIIGKIGTAGGTGYAIEFGGQVFRDMSIEGR
FT                   MTVCNMAIEAGARVGMVAVDEKTIEYVKGRSYAPKGEQWDQAVAYWNTLHSDDDAVFDA
FT                   VVELNGTEIEPQVSWGTSPEMVIPVSKAVPTLEQAKDDVQRNDWTRAYQYMGLNAGQAL
FT                   ADIQLDRVFIGSCTNSRIEDIRAAAEVVKGRKVAPSIKQAMIVPGSGLVKQQAEKEGLD
FT                   KIFLEAGFEWREPGCSMCLAMNADKLQPGEHCASTSNRNFEGRQGNGGRTHLVSPAMAA
FT                   AAAIAGHFVDVRSF"
     MAGKTLYDKL WDDHVVTQRD DGSCLLYIDR HLLHEVTSPQ AFEGLQLAGR QPWRLSANVA        60
     TPDHNVPTSK KERDQGIAGI EDDTSRIQVQ TLDDNCKAFN IVEFGINDIR QGIVHVVGPE       120
     QGLTLPGMTV VCGDSHTATH GAFGCLAHGI GTSEVEHVLA TQCLVQKKSK NMLVRVDGVL       180
     GKGVTPKDVV LAIIGKIGTA GGTGYAIEFG GQVFRDMSIE GRMTVCNMAI EAGARVGMVA       240
     VDEKTIEYVK GRSYAPKGEQ WDQAVAYWNT LHSDDDAVFD AVVELNGTEI EPQVSWGTSP       300
     EMVIPVSKAV PTLEQAKDDV QRNDWTRAYQ YMGLNAGQAL ADIQLDRVFI GSCTNSRIED       360
     IRAAAEVVKG RKVAPSIKQA MIVPGSGLVK QQAEKEGLDK IFLEAGFEWR EPGCSMCLAM       420
     NADKLQPGEH CASTSNRNFE GRQGNGGRTH LVSPAMAAAA AIAGHFVDVR SF               472
//

If you have problems or comments...

PBIL Back to PBIL home page