(data stored in ACNUC29543 zone)

EMBL: CP000521.PE397

CP000521.PE397       Location/Qualifiers
FT   CDS             456305..456814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10874"
FT                   /protein_id="ABO10874.1"
FT                   /translation="MDTVRIKQAEQENLGQNAAIYCSGAKSCEFERLNDITVVDAQTRR
FT                   ISNQAIHQGIVRLNGSVLSQSNSLYLSVPAKQYEVVIRYYPISPDRAETIHVIHQFKAN
FT                   HRYMFKMYRDKSNRSGSLLNVSVPDPLCVDLEQDGRVIRRFCRPFDVTTGLGEFLEQKK
FT                   LTPRQS"
     MDTVRIKQAE QENLGQNAAI YCSGAKSCEF ERLNDITVVD AQTRRISNQA IHQGIVRLNG        60
     SVLSQSNSLY LSVPAKQYEV VIRYYPISPD RAETIHVIHQ FKANHRYMFK MYRDKSNRSG       120
     SLLNVSVPDP LCVDLEQDGR VIRRFCRPFD VTTGLGEFLE QKKLTPRQS                   169
//

If you have problems or comments...

PBIL Back to PBIL home page