(data stored in ACNUC29543 zone)

EMBL: CP000521.PE403

CP000521.PE403       Location/Qualifiers
FT   CDS             complement(462333..463592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10880"
FT                   /protein_id="ABO10880.2"
FT                   /translation="MLYVIPFIILLVVAVILKKRENSQKQEATSPKNINRKSGKKASAK
FT                   SSKSSREKTKAKVIEENTPAIPQSNPVPEALRHNIQQLIQEKQFSAAEAQVNQALKKDN
FT                   TQHELYLLLLEIHIAQKDEFAIQQLISHIRSLGLNEIAAQAETRQKEYESSRQPDAIDF
FT                   PQAQTYEEPKNTDTTAQFDELTTSSSEASFDDLQKDYTPVKQEPAVEIEPLEFNFSFEQ
FT                   TSATENTNQPAQQPELSSTQETNELADLEFSFDLAPLHETEEKSQAVEVKADQENSINA
FT                   LDFHLDLNPSSSETKSVEQAPSLDEIKLIEQTPLEATSITPLEFSLDEPALVTAPEIEI
FT                   QNNEVVNERVTQTQIEDPLLEAFPKLKQINENELDLKLAEQYIKFGANQAARNLLQGDE
FT                   QKFNTEQQQHAKNLLNRIAS"
     MLYVIPFIIL LVVAVILKKR ENSQKQEATS PKNINRKSGK KASAKSSKSS REKTKAKVIE        60
     ENTPAIPQSN PVPEALRHNI QQLIQEKQFS AAEAQVNQAL KKDNTQHELY LLLLEIHIAQ       120
     KDEFAIQQLI SHIRSLGLNE IAAQAETRQK EYESSRQPDA IDFPQAQTYE EPKNTDTTAQ       180
     FDELTTSSSE ASFDDLQKDY TPVKQEPAVE IEPLEFNFSF EQTSATENTN QPAQQPELSS       240
     TQETNELADL EFSFDLAPLH ETEEKSQAVE VKADQENSIN ALDFHLDLNP SSSETKSVEQ       300
     APSLDEIKLI EQTPLEATSI TPLEFSLDEP ALVTAPEIEI QNNEVVNERV TQTQIEDPLL       360
     EAFPKLKQIN ENELDLKLAE QYIKFGANQA ARNLLQGDEQ KFNTEQQQHA KNLLNRIAS        419
//

If you have problems or comments...

PBIL Back to PBIL home page