(data stored in ACNUC29543 zone)

EMBL: CP000521.PE404

CP000521.PE404       Location/Qualifiers
FT   CDS             complement(463652..465016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10881"
FT                   /protein_id="ABO10881.2"
FT                   /translation="MTAYNKLKIAIFTIMSSPSLYAITLDPIQIQSAPGELLYAEMNFQ
FT                   QADPNTPLQVSLATQDDLNGLGVTHQPPGNLNFYIRQNGQGSGVIVITSSRPIIDPELN
FT                   IVVKVSEGNATRLQHIKTVLKPSPIKKAAINESPLSPQFIVNEKDIALNLPESTQYTPT
FT                   ENTSTVAETTSNEHNLNISTGTAPALNSSSPAPVAPFTEKPSTQTLQPTIATMNTESSA
FT                   VEKQPSTSLKSSDGNQTTTVKKAAQSKTAQQKNVLSKNTPKKQKISAYKGPAPTGKYVV
FT                   QRNESLWSIANRIAAQTKQPVAKVMRDIQAQNRHAFIQGDVNRLRQGSSLNLTTNTTKA
FT                   SHLKPKSSEAHLAKPSSGRAKYRLQQAEMSIVAENSPNSAHGSAKKSTQQSQNNTELAV
FT                   KVMTTRKKTVTLQRNVTKLNQTLSLKDQRIQLLNARLAELQQQLQAQQQTHKQKH"
     MTAYNKLKIA IFTIMSSPSL YAITLDPIQI QSAPGELLYA EMNFQQADPN TPLQVSLATQ        60
     DDLNGLGVTH QPPGNLNFYI RQNGQGSGVI VITSSRPIID PELNIVVKVS EGNATRLQHI       120
     KTVLKPSPIK KAAINESPLS PQFIVNEKDI ALNLPESTQY TPTENTSTVA ETTSNEHNLN       180
     ISTGTAPALN SSSPAPVAPF TEKPSTQTLQ PTIATMNTES SAVEKQPSTS LKSSDGNQTT       240
     TVKKAAQSKT AQQKNVLSKN TPKKQKISAY KGPAPTGKYV VQRNESLWSI ANRIAAQTKQ       300
     PVAKVMRDIQ AQNRHAFIQG DVNRLRQGSS LNLTTNTTKA SHLKPKSSEA HLAKPSSGRA       360
     KYRLQQAEMS IVAENSPNSA HGSAKKSTQQ SQNNTELAVK VMTTRKKTVT LQRNVTKLNQ       420
     TLSLKDQRIQ LLNARLAELQ QQLQAQQQTH KQKH                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page