(data stored in ACNUC29543 zone)

EMBL: CP000521.PE406

CP000521.PE406       Location/Qualifiers
FT   CDS             466473..467594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0428"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10883"
FT                   /protein_id="ABO10883.2"
FT                   /translation="MIYIEVLAVVVIWLSFWSLIPRDEWWFRGADFPRLQILFIGLIAL
FT                   IGMLFWPTEWDVWRELLLAVLIAAIAYQLKMVLPYTLFWKKQVKKVKQHQLDPTKQISL
FT                   IVSNVLTPNDKYHLLLEHVRTLKPDLLLTLESDTTWENALKEIEKDYPYRVPVPLDNLY
FT                   GMHLYSRLPLKNTEVKFILSNEIPSIHTTVILRSGMPVQLYCLHPKPPSPTEAKDSTLR
FT                   DAELLIVGDQIKDLDESCIVMGDLNDVAWSRTTRLFQRISGLLDPRVGRHFINTFHADY
FT                   PLLRWSLDHIFHSTDFGLVKMQRLSHIGSDHFPVYVVLQTGRIFEEIHEELEQTQADEE
FT                   EAQAAIQEGIAKAEKEEKIVTDEIAQPYKEKNI"
     MIYIEVLAVV VIWLSFWSLI PRDEWWFRGA DFPRLQILFI GLIALIGMLF WPTEWDVWRE        60
     LLLAVLIAAI AYQLKMVLPY TLFWKKQVKK VKQHQLDPTK QISLIVSNVL TPNDKYHLLL       120
     EHVRTLKPDL LLTLESDTTW ENALKEIEKD YPYRVPVPLD NLYGMHLYSR LPLKNTEVKF       180
     ILSNEIPSIH TTVILRSGMP VQLYCLHPKP PSPTEAKDST LRDAELLIVG DQIKDLDESC       240
     IVMGDLNDVA WSRTTRLFQR ISGLLDPRVG RHFINTFHAD YPLLRWSLDH IFHSTDFGLV       300
     KMQRLSHIGS DHFPVYVVLQ TGRIFEEIHE ELEQTQADEE EAQAAIQEGI AKAEKEEKIV       360
     TDEIAQPYKE KNI                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page