(data stored in ACNUC29543 zone)

EMBL: CP000521.PE407

CP000521.PE407       Location/Qualifiers
FT   CDS             468284..469570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0429"
FT                   /product="glutamate:aspartate symport protein (DAACS
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10884"
FT                   /protein_id="ABO10884.2"
FT                   /translation="MKNFKFSLAWQILIALILGIVVGAVLHNQPEIKDSIVNNVLTPLG
FT                   KIFISLIKMIVIPIVFSTLILGIAGVGSTKSLGRLGFKTILYFEIITTIAILVGLFAAN
FT                   IFHPGSGIDMSQLVQTDISQYKHTTEEVQSQSHGIIQTILSLIPTNIISSMAHGEMLPV
FT                   IFFAVLFGIGLSSLPATTKDPLLNVFHAVSETMFRVTHIIMKYAPVGVFGLIAVTVANF
FT                   GFASLIPLGKLVVLVYGAILFFALVVLGITAKMFSINIFTLFKILKDELILAYSTASSE
FT                   TVLPRIMQKMEAYGAPKAISSFVIPTGYSFNLDGSTLYQSIAAIFIAQLYGIEMSISQQ
FT                   VILVVTLMITSKGIAGVPGVSFVVLLATLGSVGIPVEGLAFIAGVDRIMDMARTALNVV
FT                   GNALAVLVISKWEKQYDYEKAAAYEASLK"
     MKNFKFSLAW QILIALILGI VVGAVLHNQP EIKDSIVNNV LTPLGKIFIS LIKMIVIPIV        60
     FSTLILGIAG VGSTKSLGRL GFKTILYFEI ITTIAILVGL FAANIFHPGS GIDMSQLVQT       120
     DISQYKHTTE EVQSQSHGII QTILSLIPTN IISSMAHGEM LPVIFFAVLF GIGLSSLPAT       180
     TKDPLLNVFH AVSETMFRVT HIIMKYAPVG VFGLIAVTVA NFGFASLIPL GKLVVLVYGA       240
     ILFFALVVLG ITAKMFSINI FTLFKILKDE LILAYSTASS ETVLPRIMQK MEAYGAPKAI       300
     SSFVIPTGYS FNLDGSTLYQ SIAAIFIAQL YGIEMSISQQ VILVVTLMIT SKGIAGVPGV       360
     SFVVLLATLG SVGIPVEGLA FIAGVDRIMD MARTALNVVG NALAVLVISK WEKQYDYEKA       420
     AAYEASLK                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page