(data stored in ACNUC29543 zone)

EMBL: CP000521.PE410

CP000521.PE410       Location/Qualifiers
FT   CDS             complement(472054..472686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0432"
FT                   /product="putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10887"
FT                   /protein_id="ABO10887.2"
FT                   /translation="MLDLSQILAFGLICLAMVLTPGPNMIYLISRSISQGKIAGFISLG
FT                   GVAVGFVFYMLCASFGITALVVAVPYAYDTIRIAGAMYLLWLAWKALRPNAAPIFNIKD
FT                   LAVDSPLKLFLMGFLTNLLNPKIAIMYLSLLPQFIHPQQGSILAQSIQLGTIQIFVSVS
FT                   VNALIVFSAGSIALFLQKKPLWASIQRWVMGTVLAGLAVRILLEHRR"
     MLDLSQILAF GLICLAMVLT PGPNMIYLIS RSISQGKIAG FISLGGVAVG FVFYMLCASF        60
     GITALVVAVP YAYDTIRIAG AMYLLWLAWK ALRPNAAPIF NIKDLAVDSP LKLFLMGFLT       120
     NLLNPKIAIM YLSLLPQFIH PQQGSILAQS IQLGTIQIFV SVSVNALIVF SAGSIALFLQ       180
     KKPLWASIQR WVMGTVLAGL AVRILLEHRR                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page