(data stored in ACNUC29543 zone)

EMBL: CP000521.PE411

CP000521.PE411       Location/Qualifiers
FT   CDS             complement(472832..474742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0433"
FT                   /product="transport protein Uup"
FT                   /note="ABC superfamily atp_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10888"
FT                   /protein_id="ABO10888.2"
FT                   /translation="MAYITLRDVQLAFGGPALLDGANFNLERGERVCLIGRNGEGKSTL
FT                   LKLIEGSLLPDSGEVSVQNGLTVSMLAQDVPMSSGKVADIVAEGAGEAAAVLKAYHEAS
FT                   DACVLGDMEACDRMGSLQHKLDQLDGWALENKVNTILGKMELDPNADLADLSGGRKRRV
FT                   LLARALLTQPDVLLLDEPTNHLDVESIEWLEKFLLDQNNLTLLFISHDRSFVDRLATRI
FT                   VELDRGILRSYEGNYSRYLDLKAQQLEAEEKQNALFEKKLAEEEAWIRQGIKARRTRNE
FT                   GRVRALKALREESKARRFQQGKVNMGVQEAQRSGKLVFDIEHLSVSYDRQTLIRDFSAI
FT                   VMRGDRIGLVGDNGVGKTTLIKAILGEVQHEGVVKTGTQLEIAYFDQLRNQLDLEKSVS
FT                   ENVSEGSDFVDVNGQRRHILSYLQDFLFSPERARTPVKALSGGERNRVLLAKLLLKPSN
FT                   LIVMDEPTNDLDMVTLELLEEMLSEYKGTLLLISHDRAFMDNVVTSTWVFDGKGGIAEY
FT                   IGGYQDYLIQRPNERVVDQKGDVKKAQAKAEAEKNAAQTNVKKVKLSYKDQRELEQLPA
FT                   EIEKLENEQAELSDKLADGSWFVTDADAATKASQRLAEIEELLLEKLERWDELEQMSKG
FT                   N"
     MAYITLRDVQ LAFGGPALLD GANFNLERGE RVCLIGRNGE GKSTLLKLIE GSLLPDSGEV        60
     SVQNGLTVSM LAQDVPMSSG KVADIVAEGA GEAAAVLKAY HEASDACVLG DMEACDRMGS       120
     LQHKLDQLDG WALENKVNTI LGKMELDPNA DLADLSGGRK RRVLLARALL TQPDVLLLDE       180
     PTNHLDVESI EWLEKFLLDQ NNLTLLFISH DRSFVDRLAT RIVELDRGIL RSYEGNYSRY       240
     LDLKAQQLEA EEKQNALFEK KLAEEEAWIR QGIKARRTRN EGRVRALKAL REESKARRFQ       300
     QGKVNMGVQE AQRSGKLVFD IEHLSVSYDR QTLIRDFSAI VMRGDRIGLV GDNGVGKTTL       360
     IKAILGEVQH EGVVKTGTQL EIAYFDQLRN QLDLEKSVSE NVSEGSDFVD VNGQRRHILS       420
     YLQDFLFSPE RARTPVKALS GGERNRVLLA KLLLKPSNLI VMDEPTNDLD MVTLELLEEM       480
     LSEYKGTLLL ISHDRAFMDN VVTSTWVFDG KGGIAEYIGG YQDYLIQRPN ERVVDQKGDV       540
     KKAQAKAEAE KNAAQTNVKK VKLSYKDQRE LEQLPAEIEK LENEQAELSD KLADGSWFVT       600
     DADAATKASQ RLAEIEELLL EKLERWDELE QMSKGN                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page