(data stored in ACNUC29543 zone)

EMBL: CP000521.PE418

CP000521.PE418       Location/Qualifiers
FT   CDS             479912..480670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10895"
FT                   /protein_id="ABO10895.2"
FT                   /translation="MWKNIRILCLLIVLLIVAVQAWRDQNQDWNQPIVVVLHPINADGL
FT                   QTTQTYIHQLQNTDFQALKSYLSEWSQHYRGQSANFKIRLGQQLQQRPPEVPQNAGIFH
FT                   VVWWSLKFRFYAWRQQQPEDNGASLKLYLNYYDPNYQKVLVHSTALEKGRIGSVNLFAT
FT                   RGQALQNQVVIVHELLHGFGAKDKYDLKTGQPIYPLGYAQPEKVPLYPQKRAEIMGGRT
FT                   PLSEQTSKMPSDLQETVIGLPTAQEVGWLK"
     MWKNIRILCL LIVLLIVAVQ AWRDQNQDWN QPIVVVLHPI NADGLQTTQT YIHQLQNTDF        60
     QALKSYLSEW SQHYRGQSAN FKIRLGQQLQ QRPPEVPQNA GIFHVVWWSL KFRFYAWRQQ       120
     QPEDNGASLK LYLNYYDPNY QKVLVHSTAL EKGRIGSVNL FATRGQALQN QVVIVHELLH       180
     GFGAKDKYDL KTGQPIYPLG YAQPEKVPLY PQKRAEIMGG RTPLSEQTSK MPSDLQETVI       240
     GLPTAQEVGW LK                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page