(data stored in ACNUC29543 zone)

EMBL: CP000521.PE421

CP000521.PE421       Location/Qualifiers
FT   CDS             483550..483789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0443"
FT                   /product="putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10898"
FT                   /protein_id="ABO10898.2"
FT                   /translation="MKILVRNLDRSVTEAEVLELFKAYGKVESCVVVTDKDTGKSKGFG
FT                   FVEMPNPREAIKAIKGLNTLKVKGYGIRVKAAEE"
     MKILVRNLDR SVTEAEVLEL FKAYGKVESC VVVTDKDTGK SKGFGFVEMP NPREAIKAIK        60
     GLNTLKVKGY GIRVKAAEE                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page