(data stored in ACNUC29543 zone)

EMBL: CP000521.PE422

CP000521.PE422       Location/Qualifiers
FT   CDS             483797..483964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3497"
FT                   /old_locus_tag="AS1_3497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89922"
FT                   /protein_id="ABS89922.2"
FT                   /translation="MQQFLALSVVAPNGTRIAQRIKTLEVRSWVPAQLPLKDLFIVENQ
FT                   NFLINDGDEG"
     MQQFLALSVV APNGTRIAQR IKTLEVRSWV PAQLPLKDLF IVENQNFLIN DGDEG             55
//

If you have problems or comments...

PBIL Back to PBIL home page