(data stored in ACNUC29543 zone)

EMBL: CP000521.PE425

CP000521.PE425       Location/Qualifiers
FT   CDS             complement(485012..486721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0446"
FT                   /product="putative transport protein (CPA2 family )"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10901"
FT                   /protein_id="ABO10901.2"
FT                   /translation="MPHDVDLIILLAVGFGVALFFGYIAARLRLPPLIGYLIAGIIISP
FT                   NTPGVEADIHLANQLAELGVMFLMFGVGMHFSLNDLLLVRRIALPGAILQIAVATLLGI
FT                   GVSMLWGWSFGSALVFGLSLSCASTVVLLKALGDRGLLDSVNGKIAVGWLLVEDLVMVL
FT                   VLVLLPATAVLLGGKAPAGAEGNIWLTLGITLLKVIGFIAFMLIVGKRVVPIIMQFVAR
FT                   LGSRELFTLTVVAAAVSIAYGSYAIFGVSMALGAFFAGMVVKESDFSHRAEEETLPLRE
FT                   IFSILFFVSVGMLFDPHILIERPLHILAVIAIIMVGKTLAAMALVLFFRYPINTALTVG
FT                   ASLAQIGEFSFILATLGVSLGLLTLEAQNLILAGALFSITLNSFIFSAIEPVQRWIRER
FT                   SHLARLLERSGDPLAMLPDEVDQSYLRDQVVIVGYGGVGRRITENLINQNIKVVIAEEN
FT                   REIVEKLRQANIAAVSGVATEPGVLIQAHIMHARLLVISPMDILDIHRIVDIAKQLNPQ
FT                   IQVLICAESKEEAAVIRDEHIGEVFYAKEEMAKNMSHHILNQIELAHQSTHH"
     MPHDVDLIIL LAVGFGVALF FGYIAARLRL PPLIGYLIAG IIISPNTPGV EADIHLANQL        60
     AELGVMFLMF GVGMHFSLND LLLVRRIALP GAILQIAVAT LLGIGVSMLW GWSFGSALVF       120
     GLSLSCASTV VLLKALGDRG LLDSVNGKIA VGWLLVEDLV MVLVLVLLPA TAVLLGGKAP       180
     AGAEGNIWLT LGITLLKVIG FIAFMLIVGK RVVPIIMQFV ARLGSRELFT LTVVAAAVSI       240
     AYGSYAIFGV SMALGAFFAG MVVKESDFSH RAEEETLPLR EIFSILFFVS VGMLFDPHIL       300
     IERPLHILAV IAIIMVGKTL AAMALVLFFR YPINTALTVG ASLAQIGEFS FILATLGVSL       360
     GLLTLEAQNL ILAGALFSIT LNSFIFSAIE PVQRWIRERS HLARLLERSG DPLAMLPDEV       420
     DQSYLRDQVV IVGYGGVGRR ITENLINQNI KVVIAEENRE IVEKLRQANI AAVSGVATEP       480
     GVLIQAHIMH ARLLVISPMD ILDIHRIVDI AKQLNPQIQV LICAESKEEA AVIRDEHIGE       540
     VFYAKEEMAK NMSHHILNQI ELAHQSTHH                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page