(data stored in ACNUC29543 zone)

EMBL: CP000521.PE431

CP000521.PE431       Location/Qualifiers
FT   CDS             491024..491779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10907"
FT                   /protein_id="ABO10907.2"
FT                   /translation="MSQSSAALNSPNPMKKKVITALIAVAIGHIGVLWAVSHIKPVELK
FT                   PIEKKPLQVRFVKIQEQPKPLPPKPKEPPKKPEPKKEVKEVKVVEKPVTPPKKVEKIQQ
FT                   VKKAETPKETVKTEPKVEPKIVTPTTTVTEKVVEKPKPVVQEAPKAQPAPDPSPKRVSI
FT                   GGSGVQWSRSPRLTVSPKDLQGEARSVVVLIEADEKGKITNVRVTRSSGIPSLDDKVVR
FT                   AVRSAKFKPYMENGVAYPIKAEQPFDLTP"
     MSQSSAALNS PNPMKKKVIT ALIAVAIGHI GVLWAVSHIK PVELKPIEKK PLQVRFVKIQ        60
     EQPKPLPPKP KEPPKKPEPK KEVKEVKVVE KPVTPPKKVE KIQQVKKAET PKETVKTEPK       120
     VEPKIVTPTT TVTEKVVEKP KPVVQEAPKA QPAPDPSPKR VSIGGSGVQW SRSPRLTVSP       180
     KDLQGEARSV VVLIEADEKG KITNVRVTRS SGIPSLDDKV VRAVRSAKFK PYMENGVAYP       240
     IKAEQPFDLT P                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page