(data stored in ACNUC29543 zone)

EMBL: CP000521.PE432

CP000521.PE432       Location/Qualifiers
FT   CDS             491824..492444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0453"
FT                   /product="putative biopolymer transport protein (ExbB)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10908"
FT                   /protein_id="ABO10908.2"
FT                   /translation="MNFSIYWQHADAVSKTLYFILLAMSIATWTVFILRLMGTRQLKQQ
FT                   AYAQLSQAITSLKAKLQPLSFEQRKAVAEQALLRQISAEKANADKGISVLGTIASIAPF
FT                   VGLFGTVWGIFHALVAVGKSGQAGLAQVATPVGEALIMTGLGLAVAIPAVLAYNICVRA
FT                   NRGLAHDLQDQAHSLLIDTMLQQDSTVKSDVKTAQQSYVGGQA"
     MNFSIYWQHA DAVSKTLYFI LLAMSIATWT VFILRLMGTR QLKQQAYAQL SQAITSLKAK        60
     LQPLSFEQRK AVAEQALLRQ ISAEKANADK GISVLGTIAS IAPFVGLFGT VWGIFHALVA       120
     VGKSGQAGLA QVATPVGEAL IMTGLGLAVA IPAVLAYNIC VRANRGLAHD LQDQAHSLLI       180
     DTMLQQDSTV KSDVKTAQQS YVGGQA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page