(data stored in ACNUC29543 zone)

EMBL: CP000521.PE434

CP000521.PE434       Location/Qualifiers
FT   CDS             complement(492909..493430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0455"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /note="Protein-methionine-S-oxide reductase; Peptide MetO
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10910"
FT                   /db_xref="GOA:A3M1W6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1W6"
FT                   /protein_id="ABO10910.2"
FT                   /translation="MQQALFGGGCFWCVEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVC
FT                   QGDTQHAEVVLIDFDEQQVTYSQLLDVFFATHDPTTLNRQGNDIGTQYRSVIYYFNEEQ
FT                   KQAAEHTIQTLKDDDLDIVTELSPTPTFYPAEDYHQNYYEKNPSQGYCNFAIPPKLLKL
FT                   HSKFQHLMKN"
     MQQALFGGGC FWCVEAVFLQ IRGVEKVTSG YAGGHTTHPT YEQVCQGDTQ HAEVVLIDFD        60
     EQQVTYSQLL DVFFATHDPT TLNRQGNDIG TQYRSVIYYF NEEQKQAAEH TIQTLKDDDL       120
     DIVTELSPTP TFYPAEDYHQ NYYEKNPSQG YCNFAIPPKL LKLHSKFQHL MKN              173
//

If you have problems or comments...

PBIL Back to PBIL home page