(data stored in ACNUC29543 zone)

EMBL: CP000521.PE443

CP000521.PE443       Location/Qualifiers
FT   CDS             complement(503555..504325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0464"
FT                   /product="Sec-independent protein translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10919"
FT                   /protein_id="ABO10919.2"
FT                   /translation="MNQLPSTAVNSQENLDQMPIMNHLVVLRRHLFRIVGVTLFLFFCL
FT                   LPFRNHTYQLLSEPLRLQLPASSSMIATDVTATFMAPFKLNLFVALMLAMPFILYEIWS
FT                   FVRPALYQKERHLALPLLIGSIILFYAGVAFAYYITLPAILHFFISVSPETVAPMTDIN
FT                   SYLSFCLKLFLVFGVTFEIPIATLLLILIGVVNTQSLAEKRRFIIVGCFFVAMFITPPD
FT                   AISMVMLAIPMWLLFEIGLLFGKILEKRKTHSAE"
     MNQLPSTAVN SQENLDQMPI MNHLVVLRRH LFRIVGVTLF LFFCLLPFRN HTYQLLSEPL        60
     RLQLPASSSM IATDVTATFM APFKLNLFVA LMLAMPFILY EIWSFVRPAL YQKERHLALP       120
     LLIGSIILFY AGVAFAYYIT LPAILHFFIS VSPETVAPMT DINSYLSFCL KLFLVFGVTF       180
     EIPIATLLLI LIGVVNTQSL AEKRRFIIVG CFFVAMFITP PDAISMVMLA IPMWLLFEIG       240
     LLFGKILEKR KTHSAE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page