(data stored in ACNUC29543 zone)

EMBL: CP000521.PE444

CP000521.PE444       Location/Qualifiers
FT   CDS             complement(504322..504759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0465"
FT                   /product="Sec-independent protein translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10920"
FT                   /db_xref="GOA:A3M1X6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1X6"
FT                   /protein_id="ABO10920.1"
FT                   /translation="MLDVGMTELLCFAIIAILVLGPEKLPEAARFAGRWYVRLKRYITN
FT                   LQNEIDQELRLSEFRKEMQEELNRIEALERKVQQQLDEIQKQQVSESLEVTETAKTTQK
FT                   PIWKCTPISGHYKVPYLTKVTSLAAQTDISETSPVELKIAV"
     MLDVGMTELL CFAIIAILVL GPEKLPEAAR FAGRWYVRLK RYITNLQNEI DQELRLSEFR        60
     KEMQEELNRI EALERKVQQQ LDEIQKQQVS ESLEVTETAK TTQKPIWKCT PISGHYKVPY       120
     LTKVTSLAAQ TDISETSPVE LKIAV                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page