(data stored in ACNUC29543 zone)

EMBL: CP000521.PE447

CP000521.PE447       Location/Qualifiers
FT   CDS             complement(506310..506933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10923"
FT                   /db_xref="GOA:A3M1X9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1X9"
FT                   /protein_id="ABO10923.2"
FT                   /translation="MSTPHWFDQGSLVLASNNKGKVAEFEKLFEQLKLPVEIIPQGRLN
FT                   IPDAIEDGLSFIENAIIKARHASKISGKPAMADDSGICVPVLGGAPGIYSARYAGEHGD
FT                   DAANNAKLLNDLLPFRKNGEVIEGMFVCVLALVTHAEDPLPQIFQGIWHGEILEAPRGE
FT                   NGFGYDPLFWLPELQVSSAELSKEEKNKISHRGQAMQLFRESLV"
     MSTPHWFDQG SLVLASNNKG KVAEFEKLFE QLKLPVEIIP QGRLNIPDAI EDGLSFIENA        60
     IIKARHASKI SGKPAMADDS GICVPVLGGA PGIYSARYAG EHGDDAANNA KLLNDLLPFR       120
     KNGEVIEGMF VCVLALVTHA EDPLPQIFQG IWHGEILEAP RGENGFGYDP LFWLPELQVS       180
     SAELSKEEKN KISHRGQAMQ LFRESLV                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page