(data stored in ACNUC29543 zone)

EMBL: CP000521.PE453

CP000521.PE453       Location/Qualifiers
FT   CDS             complement(512467..514677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0474"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10929"
FT                   /protein_id="ABO10929.1"
FT                   /translation="MAQEAVSQLPTIHTKATQEESLKVDQSANSKFVAPLKDTPKSVSI
FT                   LSQKLIKDTNSNTLLEALRYEPGITLGAGEGGTPFTDMPYIRGYSGQSSIYVDGVRNTT
FT                   SQNRDMFAIEQVEVIKGSSSALGGGGSVGGSINLIPKVAHEGDVYQGSVQSGTDNYRHI
FT                   QLDANKDFGNGIAGRVVIMGHENEKAGQSNGAEYKRVGIAPSITFGLDTATRGTLSYYY
FT                   LRSNDEPDAGIPFNNANPAKPPVGVTVTPGDGKPVDVKAGTYYGWKARDFDKRENHIGT
FT                   FKLEHDFNENLTLSNIATYNKSKSDYVYTNADDSKGNIYRGTVARRALSRILDTDAYSD
FT                   QLSLRGKFNTGSLKHSFNVGTEWSFQETDQGVHTFTNAAGETTSTILDSNIQNCTSAAA
FT                   VANGWCTSLNNPGNGAFTDKRGSITAQSTTRSHNVGIYALDSIEFNPQWLLNLGVRWDK
FT                   FETEKKYNKDVDGRTPHKAGDKLESDTDYFSYQAGLVFKPTEDGSIYLSYATSANPVGV
FT                   LAEGDTGSDSISDSGTASASANALKPEEARTFELGTKWDLFNNRANLTAAVFRTEKQNT
FT                   RIQIDPTTTANAGKSKVDGFEISLNGKITDKWDVSTGYSYLDSEITEAAYNAVAQEGKP
FT                   LPFVAKNSATLWSTYRVMPQLTLGAGVEYRDQVFVNTTAPKYLPTYTIYNAMAKYDVNK
FT                   NVNLQLNINNISDKRYFTSAHAAHYAFEGNGRNAVLAINFKY"
     MAQEAVSQLP TIHTKATQEE SLKVDQSANS KFVAPLKDTP KSVSILSQKL IKDTNSNTLL        60
     EALRYEPGIT LGAGEGGTPF TDMPYIRGYS GQSSIYVDGV RNTTSQNRDM FAIEQVEVIK       120
     GSSSALGGGG SVGGSINLIP KVAHEGDVYQ GSVQSGTDNY RHIQLDANKD FGNGIAGRVV       180
     IMGHENEKAG QSNGAEYKRV GIAPSITFGL DTATRGTLSY YYLRSNDEPD AGIPFNNANP       240
     AKPPVGVTVT PGDGKPVDVK AGTYYGWKAR DFDKRENHIG TFKLEHDFNE NLTLSNIATY       300
     NKSKSDYVYT NADDSKGNIY RGTVARRALS RILDTDAYSD QLSLRGKFNT GSLKHSFNVG       360
     TEWSFQETDQ GVHTFTNAAG ETTSTILDSN IQNCTSAAAV ANGWCTSLNN PGNGAFTDKR       420
     GSITAQSTTR SHNVGIYALD SIEFNPQWLL NLGVRWDKFE TEKKYNKDVD GRTPHKAGDK       480
     LESDTDYFSY QAGLVFKPTE DGSIYLSYAT SANPVGVLAE GDTGSDSISD SGTASASANA       540
     LKPEEARTFE LGTKWDLFNN RANLTAAVFR TEKQNTRIQI DPTTTANAGK SKVDGFEISL       600
     NGKITDKWDV STGYSYLDSE ITEAAYNAVA QEGKPLPFVA KNSATLWSTY RVMPQLTLGA       660
     GVEYRDQVFV NTTAPKYLPT YTIYNAMAKY DVNKNVNLQL NINNISDKRY FTSAHAAHYA       720
     FEGNGRNAVL AINFKY                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page