(data stored in ACNUC29543 zone)

EMBL: CP000521.PE459

CP000521.PE459       Location/Qualifiers
FT   CDS             complement(519606..519785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0479"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10934"
FT                   /protein_id="ABO10934.1"
FT                   /translation="MKTPEGQSITRKNVQIMGQISEYMMELGQQTFNDPKARDHMQEEM
FT                   LKIIAPLMKDKEKS"
     MKTPEGQSIT RKNVQIMGQI SEYMMELGQQ TFNDPKARDH MQEEMLKIIA PLMKDKEKS         59
//

If you have problems or comments...

PBIL Back to PBIL home page