(data stored in ACNUC29543 zone)

EMBL: CP000521.PE466

CP000521.PE466       Location/Qualifiers
FT   CDS             530276..530788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0486"
FT                   /product="thermoresistant gluconokinase"
FT                   /note="gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10941"
FT                   /protein_id="ABO10941.2"
FT                   /translation="MIVIAMGVCGTGKTLIGELLSERLACEFLDGDTLHSAANKSKMSQ
FT                   GIPLTDEDRLPWLQAIRQAIEAKQRDGETAVFTCSSLKRMYRDILRGQDQNVKFVYLKG
FT                   SYELLQQRLAERSGHFFDPALLQTQLDTLEEPDVNEAIAIDIALTPEQIIEQVIQKLGV
FT                   TDSVCRG"
     MIVIAMGVCG TGKTLIGELL SERLACEFLD GDTLHSAANK SKMSQGIPLT DEDRLPWLQA        60
     IRQAIEAKQR DGETAVFTCS SLKRMYRDIL RGQDQNVKFV YLKGSYELLQ QRLAERSGHF       120
     FDPALLQTQL DTLEEPDVNE AIAIDIALTP EQIIEQVIQK LGVTDSVCRG                  170
//

If you have problems or comments...

PBIL Back to PBIL home page