(data stored in ACNUC29543 zone)

EMBL: CP000521.PE469

CP000521.PE469       Location/Qualifiers
FT   CDS             complement(535624..536466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10944"
FT                   /protein_id="ABO10944.2"
FT                   /translation="MTQHLSKHRHISFTAHYTGYIWYQMGISHEALATSKGKSLAYLVH
FT                   PLESWAEKYVGGSMRTTLKQRHTMLDHDLEKLIQENPDLQVLEIACGLSPRGWWFRQHY
FT                   PSISYRELDLPDMAQTKQNALQQIEKNAPEVLSVDLFTEAFAQAFEVFDSNRPLVVISE
FT                   GLINYFDKDLLKQLIQSIAHYGASFKKLHYLTDLYPEPVKNKLANIIWNSSKLLKLMSR
FT                   SSFSFHFKTPLEVKNFFKDAGFSQVNVEQPQIFFEQVSKDSDEEHLGDLVWTIHAQLK"
     MTQHLSKHRH ISFTAHYTGY IWYQMGISHE ALATSKGKSL AYLVHPLESW AEKYVGGSMR        60
     TTLKQRHTML DHDLEKLIQE NPDLQVLEIA CGLSPRGWWF RQHYPSISYR ELDLPDMAQT       120
     KQNALQQIEK NAPEVLSVDL FTEAFAQAFE VFDSNRPLVV ISEGLINYFD KDLLKQLIQS       180
     IAHYGASFKK LHYLTDLYPE PVKNKLANII WNSSKLLKLM SRSSFSFHFK TPLEVKNFFK       240
     DAGFSQVNVE QPQIFFEQVS KDSDEEHLGD LVWTIHAQLK                             280
//

If you have problems or comments...

PBIL Back to PBIL home page