(data stored in ACNUC29543 zone)

EMBL: CP000521.PE475

CP000521.PE475       Location/Qualifiers
FT   CDS             542298..542552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10950"
FT                   /protein_id="ABO10950.2"
FT                   /translation="MGLRWTDTIDIAIELSEAHPEVDPQWIRFTDLHAWVCALPDFSDD
FT                   PNKSTEGLLEAIRWLGWMKFAKNSRKNRNFYTFKADYCL"
     MGLRWTDTID IAIELSEAHP EVDPQWIRFT DLHAWVCALP DFSDDPNKST EGLLEAIRWL        60
     GWMKFAKNSR KNRNFYTFKA DYCL                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page