(data stored in ACNUC29543 zone)

EMBL: CP000521.PE476

CP000521.PE476       Location/Qualifiers
FT   CDS             542611..543042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0498"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="NDK; NDP kinase; Nucleoside-2-P kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10951"
FT                   /db_xref="GOA:A3M207"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M207"
FT                   /protein_id="ABO10951.2"
FT                   /translation="MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQA
FT                   DAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIR
FT                   ADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR"
     MAIERTLSIV KPDAVSKNHI GEIFARFEKA GLKIVATKMK HLSQADAEGF YAEHKERGFF        60
     GDLVAFMTSG PVVVSVLEGE NAVLAHREIL GATNPKEAAP GTIRADFAVS IDENAAHGSD       120
     SVASAEREIA YFFADNEICP RTR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page