(data stored in ACNUC29543 zone)

EMBL: CP000521.PE478

CP000521.PE478       Location/Qualifiers
FT   CDS             544437..545213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0500"
FT                   /product="type 4 fimbrial biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10953"
FT                   /protein_id="ABO10953.2"
FT                   /translation="MLCMGVAVALLASGCQTSQTVKKDPEKAVKVRTQLAAEYIRSGDL
FT                   DSAKRSLDQALSVDSRDATANMMMGILLQQEGSKPNLEKAEHYFKRAISSEPDNAQAHN
FT                   NYGTYLYQMERYNDAIEQFRIAGATLGYDQRYQALENLGRIYLKLGDIASAEKTFKQAL
FT                   LANRDSYISMLELAEIFYLQQQIPAATQMYEQYVRTVGQKNQGARALWIGLRVARANAD
FT                   KMGMQVLVNQLRALFPESPEYQRYLQLQYSTEAVWK"
     MLCMGVAVAL LASGCQTSQT VKKDPEKAVK VRTQLAAEYI RSGDLDSAKR SLDQALSVDS        60
     RDATANMMMG ILLQQEGSKP NLEKAEHYFK RAISSEPDNA QAHNNYGTYL YQMERYNDAI       120
     EQFRIAGATL GYDQRYQALE NLGRIYLKLG DIASAEKTFK QALLANRDSY ISMLELAEIF       180
     YLQQQIPAAT QMYEQYVRTV GQKNQGARAL WIGLRVARAN ADKMGMQVLV NQLRALFPES       240
     PEYQRYLQLQ YSTEAVWK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page