(data stored in ACNUC29543 zone)

EMBL: CP000521.PE482

CP000521.PE482       Location/Qualifiers
FT   CDS             548450..549148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10957"
FT                   /protein_id="ABO10957.2"
FT                   /translation="MSLSDEEQFDSLKSFAKKYGSAMISGILIALIAFFGWEYWQKRNL
FT                   ATSQTETAKVQQLMDEANATADNPNALASITASADKIVKDDIDSVQAIQTQFVLAKLAY
FT                   EKQDYAAAEKALKKVENSKVKDEGLIQVVKLRLADAQLAQNKYDEALKTLSGDVDPAFK
FT                   ATVEELRGDIFVAKKDIDSAKKAYQAAWDSLLERKQERQILQIKLESVGVLVEDPQIER
FT                   PILETQVEES"
     MSLSDEEQFD SLKSFAKKYG SAMISGILIA LIAFFGWEYW QKRNLATSQT ETAKVQQLMD        60
     EANATADNPN ALASITASAD KIVKDDIDSV QAIQTQFVLA KLAYEKQDYA AAEKALKKVE       120
     NSKVKDEGLI QVVKLRLADA QLAQNKYDEA LKTLSGDVDP AFKATVEELR GDIFVAKKDI       180
     DSAKKAYQAA WDSLLERKQE RQILQIKLES VGVLVEDPQI ERPILETQVE ES               232
//

If you have problems or comments...

PBIL Back to PBIL home page