(data stored in ACNUC29543 zone)

EMBL: CP000521.PE483

CP000521.PE483       Location/Qualifiers
FT   CDS             549148..550293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10958"
FT                   /protein_id="ABO10958.2"
FT                   /translation="MNQKFKLPLAIAIASAVLVGCSSNKVKEAKPNPLPKLTESNKSLV
FT                   PVFSRSVSSTNKADPLRLQLDASEGVVFTLDPKGEVAAYRGKQRLWEKKVSKLGLSSGV
FT                   EAAEGIVVVGNSKGQLFALDQATGEQKWTAQLSGALLSPSLVQSGRVITIANDGTVFAH
FT                   DVSSGQQVWAYKLPNVQFSLRGQPSPVSLDPRTVLIASANAYVYAIDTISGIPRFQRRV
FT                   AVSEGRSDIQRLIDIDGDPVVAGQLMVTTSFQGQVTVTDLASQRVVWSEDSSSTKRPEV
FT                   YDNKVFVSSTDGKLTAYDLTTGEQLWQNDSLLNRHLSNPVVLGSDLIVGDLDGVLHLID
FT                   PTTGKLIGRSKTSGEVNTLRVIENQLYVSTRKGDLSIWQNR"
     MNQKFKLPLA IAIASAVLVG CSSNKVKEAK PNPLPKLTES NKSLVPVFSR SVSSTNKADP        60
     LRLQLDASEG VVFTLDPKGE VAAYRGKQRL WEKKVSKLGL SSGVEAAEGI VVVGNSKGQL       120
     FALDQATGEQ KWTAQLSGAL LSPSLVQSGR VITIANDGTV FAHDVSSGQQ VWAYKLPNVQ       180
     FSLRGQPSPV SLDPRTVLIA SANAYVYAID TISGIPRFQR RVAVSEGRSD IQRLIDIDGD       240
     PVVAGQLMVT TSFQGQVTVT DLASQRVVWS EDSSSTKRPE VYDNKVFVSS TDGKLTAYDL       300
     TTGEQLWQND SLLNRHLSNP VVLGSDLIVG DLDGVLHLID PTTGKLIGRS KTSGEVNTLR       360
     VIENQLYVST RKGDLSIWQN R                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page