(data stored in ACNUC29543 zone)

EMBL: CP000521.PE487

CP000521.PE487       Location/Qualifiers
FT   CDS             553491..553619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0509"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10962"
FT                   /protein_id="ABO10962.1"
FT                   /translation="MSNLADELKQMIIDVLALEDITIADIDTEAPLFGEGLGLDSI"
     MSNLADELKQ MIIDVLALED ITIADIDTEA PLFGEGLGLD SI                           42
//

If you have problems or comments...

PBIL Back to PBIL home page