(data stored in ACNUC29543 zone)

EMBL: CP000521.PE489

CP000521.PE489       Location/Qualifiers
FT   CDS             553764..554012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0510"
FT                   /product="putative acyl carrier protein (ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10963"
FT                   /protein_id="ABO10963.2"
FT                   /translation="MLSQEQVLTKLREWMEDLFEIEPETVQLDSNLYSDLDVDSIDAVD
FT                   LVVKIKELTGKQVKPEDFKNVRTVLDVVTVIQNMTAE"
     MLSQEQVLTK LREWMEDLFE IEPETVQLDS NLYSDLDVDS IDAVDLVVKI KELTGKQVKP        60
     EDFKNVRTVL DVVTVIQNMT AE                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page