(data stored in ACNUC29543 zone)

EMBL: CP000521.PE491

CP000521.PE491       Location/Qualifiers
FT   CDS             554573..556231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10965"
FT                   /protein_id="ABO10965.2"
FT                   /translation="MYCHFQKFIDSAQPLCIDGTLNSTSFNQFWQDVALQAAAIAQMEN
FT                   LTWALWEADSYEFLVLFFAALLAKKQILLPPNRVRELEQDFSAQQIYFLKRQEIGEVVP
FT                   LSLTLDDTFLEQAQLYFYTSGSTGEPKKIPRTLRQLLNEVQGLSQSFSFDEHATAIATV
FT                   SHQHIYGLLFKLLLPLARGRSFYNPQMAFPEDVVQAQKQLETMGLSNYLISSPALLKRW
FT                   TTDVVLQDCQMVFSSGGKLESGVRPLLNRPIIEVLGSSETGGIAHRAKDEDAWTAFSNV
FT                   AIRIEDQQLMVKSNHAYENDWITTGDGAAWTDATCQIFKLLGRTDRIVKLEEKRLSLDA
FT                   IEQSIQALDVVKQCHVLVFEHEQRQMLGCIVVLTEQAREQLQQQGKLAFVSHLKQQLKD
FT                   GLETIAIPRQWRFLSQLPQNTQSKLNKNYLKTLFKPMLQPVVLSQSQNSDDHIWELEFP
FT                   PELACFKGHFPTQPIYPGVGQIGFLQHFAKSIWSDLSWCQGYEQLKFQNLIRPYAVVQL
FT                   KLARKEHKVSFELRDSEHILASGRLLFALQTEVED"
     MYCHFQKFID SAQPLCIDGT LNSTSFNQFW QDVALQAAAI AQMENLTWAL WEADSYEFLV        60
     LFFAALLAKK QILLPPNRVR ELEQDFSAQQ IYFLKRQEIG EVVPLSLTLD DTFLEQAQLY       120
     FYTSGSTGEP KKIPRTLRQL LNEVQGLSQS FSFDEHATAI ATVSHQHIYG LLFKLLLPLA       180
     RGRSFYNPQM AFPEDVVQAQ KQLETMGLSN YLISSPALLK RWTTDVVLQD CQMVFSSGGK       240
     LESGVRPLLN RPIIEVLGSS ETGGIAHRAK DEDAWTAFSN VAIRIEDQQL MVKSNHAYEN       300
     DWITTGDGAA WTDATCQIFK LLGRTDRIVK LEEKRLSLDA IEQSIQALDV VKQCHVLVFE       360
     HEQRQMLGCI VVLTEQAREQ LQQQGKLAFV SHLKQQLKDG LETIAIPRQW RFLSQLPQNT       420
     QSKLNKNYLK TLFKPMLQPV VLSQSQNSDD HIWELEFPPE LACFKGHFPT QPIYPGVGQI       480
     GFLQHFAKSI WSDLSWCQGY EQLKFQNLIR PYAVVQLKLA RKEHKVSFEL RDSEHILASG       540
     RLLFALQTEV ED                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page