(data stored in ACNUC29543 zone)

EMBL: CP000521.PE496

CP000521.PE496       Location/Qualifiers
FT   CDS             complement(559466..559846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10970"
FT                   /protein_id="ABO10970.1"
FT                   /translation="MHSSDQTKPVAIENTFHELQYSPPPVWYNPWLNVSLTQHQKSNNQ
FT                   FSNGFPILLKWPEPESFVQTQYRMHSEHGFQSQAMHSLILSSAYSCNEIDRAICSAQSQ
FT                   NILNSVHAKPHSWYRHHEMEFQ"
     MHSSDQTKPV AIENTFHELQ YSPPPVWYNP WLNVSLTQHQ KSNNQFSNGF PILLKWPEPE        60
     SFVQTQYRMH SEHGFQSQAM HSLILSSAYS CNEIDRAICS AQSQNILNSV HAKPHSWYRH       120
     HEMEFQ                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page