(data stored in ACNUC29543 zone)

EMBL: CP000521.PE497

CP000521.PE497       Location/Qualifiers
FT   CDS             559878..560507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10971"
FT                   /protein_id="ABO10971.2"
FT                   /translation="MSKFIKTLGLGAAVWMSSLSAVYAAPTQITQIFQQLSQSPTVRAD
FT                   FEQQKKLPSLNKTFVSNGSLLFSKSYGVAWQIKRPVQAVLIVTPTKLVQKTQRTFSQIQ
FT                   VDQSPYSSVATLFLQLMSGNEQALAKNFNVVSANYSPAGWSMSLTPKSSLFKKLFVRVD
FT                   AQGQQYVNQIVITEKANNLTTIRFSHQTSQPTTLTAAEHAIFQLAK"
     MSKFIKTLGL GAAVWMSSLS AVYAAPTQIT QIFQQLSQSP TVRADFEQQK KLPSLNKTFV        60
     SNGSLLFSKS YGVAWQIKRP VQAVLIVTPT KLVQKTQRTF SQIQVDQSPY SSVATLFLQL       120
     MSGNEQALAK NFNVVSANYS PAGWSMSLTP KSSLFKKLFV RVDAQGQQYV NQIVITEKAN       180
     NLTTIRFSHQ TSQPTTLTAA EHAIFQLAK                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page