(data stored in ACNUC29543 zone)

EMBL: CP000521.PE500

CP000521.PE500       Location/Qualifiers
FT   CDS             564125..564670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10974"
FT                   /protein_id="ABO10974.2"
FT                   /translation="MQRKWATILLSSFIFLNGCQVMPHAKGLQSPLWQAQTYQRQDQVE
FT                   VQWKQQSFSFLLYQQQKGAVLDMVALSLTGQQLFKLQFDGHRVHVEQRIDQMRLLPFEF
FT                   VVRDLLFATYPQFSHLGQQAVEMKQQADKQVVYIEKQPVLQVKQGQGSIELINEQVPYT
FT                   MTLSSIENTLQTEESSTP"
     MQRKWATILL SSFIFLNGCQ VMPHAKGLQS PLWQAQTYQR QDQVEVQWKQ QSFSFLLYQQ        60
     QKGAVLDMVA LSLTGQQLFK LQFDGHRVHV EQRIDQMRLL PFEFVVRDLL FATYPQFSHL       120
     GQQAVEMKQQ ADKQVVYIEK QPVLQVKQGQ GSIELINEQV PYTMTLSSIE NTLQTEESST       180
     P                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page