(data stored in ACNUC29543 zone)

EMBL: CP000521.PE501

CP000521.PE501       Location/Qualifiers
FT   CDS             564667..565869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10975"
FT                   /protein_id="ABO10975.2"
FT                   /translation="MKHLPSANAAPMAVGIQFSVGLSALGSELNQIKQALQEPQQILTL
FT                   RNDLIADHDVWVGQYTHPLCSSVPDALQSVDSRNLRFALTALSKIETELKAYTASFENK
FT                   RLAIVVGTSTSGIADNELLLKQYFQGQTDLSISHYPQEMSCLAKALQLYLGWEGPAYTI
FT                   STACSSSAKALAAGQRLLHADLADVVLVGGVDTLCKLTLNGFNSLESLSEHICQPCGLN
FT                   RDGINIGEAAAFFVLSKEQAPVMLMGAGESMDAWHISAPHPEGKGAALAMQCALDMAHI
FT                   SAQEVGYINLHGTATPQNDAMEIKAVRQVFGDYPVALSSTKHKTGHCLGAAGAIEAFIC
FT                   EQVLKDQNWLPLHQNVEIDPDLADQNYVQEAELKQPIRYVMSNSFAFGGSNISLVFGVK
FT                   P"
     MKHLPSANAA PMAVGIQFSV GLSALGSELN QIKQALQEPQ QILTLRNDLI ADHDVWVGQY        60
     THPLCSSVPD ALQSVDSRNL RFALTALSKI ETELKAYTAS FENKRLAIVV GTSTSGIADN       120
     ELLLKQYFQG QTDLSISHYP QEMSCLAKAL QLYLGWEGPA YTISTACSSS AKALAAGQRL       180
     LHADLADVVL VGGVDTLCKL TLNGFNSLES LSEHICQPCG LNRDGINIGE AAAFFVLSKE       240
     QAPVMLMGAG ESMDAWHISA PHPEGKGAAL AMQCALDMAH ISAQEVGYIN LHGTATPQND       300
     AMEIKAVRQV FGDYPVALSS TKHKTGHCLG AAGAIEAFIC EQVLKDQNWL PLHQNVEIDP       360
     DLADQNYVQE AELKQPIRYV MSNSFAFGGS NISLVFGVKP                             400
//

If you have problems or comments...

PBIL Back to PBIL home page