(data stored in ACNUC29543 zone)

EMBL: CP000521.PE502

CP000521.PE502       Location/Qualifiers
FT   CDS             565869..566294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0523"
FT                   /product="putative 3-hydroxylacyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10976"
FT                   /protein_id="ABO10976.2"
FT                   /translation="MKLDAIQYIPHEQPMVFIDHLTEVAEGRAQAELTITPELMFCEAE
FT                   GLPTWASIEIMAQTISAYSGWQGQQSKQAPKVGFLLGTRKLNLPIPYFALGSRLIIQIE
FT                   QQYFHEGLGQFSCEIQYAEHCIQATLSVFEPTESPFE"
     MKLDAIQYIP HEQPMVFIDH LTEVAEGRAQ AELTITPELM FCEAEGLPTW ASIEIMAQTI        60
     SAYSGWQGQQ SKQAPKVGFL LGTRKLNLPI PYFALGSRLI IQIEQQYFHE GLGQFSCEIQ       120
     YAEHCIQATL SVFEPTESPF E                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page