(data stored in ACNUC29543 zone)

EMBL: CP000521.PE503

CP000521.PE503       Location/Qualifiers
FT   CDS             566318..567043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10977"
FT                   /protein_id="ABO10977.2"
FT                   /translation="MTRRILVTGSSRGIGKAIALQLAKAGFDVTVHARSRQAEAEQVVQ
FT                   EIQALGQNSHYLMFNVNERQTVQQILEQDVEQHGAFYGVVLNAGLTHDGAFPALTDQDW
FT                   DEVISTSLDGFYNVLKPLIMPMIHLRKGGRIVTLSSVSGIMGNRGQVNYSAAKAGLIGA
FT                   TKALALELAKRKITVNCVAPGLIETEMVTDEVKEHALKMIPLQRMGQVDEVASVVKFLC
FT                   SDEASYVTRQVISVNGGLI"
     MTRRILVTGS SRGIGKAIAL QLAKAGFDVT VHARSRQAEA EQVVQEIQAL GQNSHYLMFN        60
     VNERQTVQQI LEQDVEQHGA FYGVVLNAGL THDGAFPALT DQDWDEVIST SLDGFYNVLK       120
     PLIMPMIHLR KGGRIVTLSS VSGIMGNRGQ VNYSAAKAGL IGATKALALE LAKRKITVNC       180
     VAPGLIETEM VTDEVKEHAL KMIPLQRMGQ VDEVASVVKF LCSDEASYVT RQVISVNGGL       240
     I                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page