(data stored in ACNUC29543 zone)

EMBL: CP000521.PE505

CP000521.PE505       Location/Qualifiers
FT   CDS             568281..568715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10979"
FT                   /protein_id="ABO10979.1"
FT                   /translation="MLNKKLLFVAMLSAGFTATVQAADEVHHLNFKEAVDRAVADGTLD
FT                   GSVKFYLKGTKSGGKVIQKDAVTNKKTNGFGKSAATSCDWVLRSALIQMQNNAKAQGAN
FT                   AVTNIVSYFKANETTSTTTYDCYKGTMMAGVALKGDVVKF"
     MLNKKLLFVA MLSAGFTATV QAADEVHHLN FKEAVDRAVA DGTLDGSVKF YLKGTKSGGK        60
     VIQKDAVTNK KTNGFGKSAA TSCDWVLRSA LIQMQNNAKA QGANAVTNIV SYFKANETTS       120
     TTTYDCYKGT MMAGVALKGD VVKF                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page