(data stored in ACNUC29543 zone)

EMBL: CP000521.PE506

CP000521.PE506       Location/Qualifiers
FT   CDS             568739..569395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0527"
FT                   /product="putative holo-(acyl carrier protein) synthase 2"
FT                   /note="AcpT; phophopantetheinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10980"
FT                   /protein_id="ABO10980.2"
FT                   /translation="MSKRKIEVYTQALSQLLLKSKQDFPDFRSFNHYKKQQIKSVRNRL
FT                   IAEKLRLTSMELEFAKHEHGKPYLLNHTLHFNHSHSQQYYALALSERIKDIGIDVEELD
FT                   RKVRLDSLAQHAFHPDEYATWQSLEQDREYWFKVWTTKEAVLKASGLGIRLDLNTLNTQ
FT                   AHPTNHGGLCSHELIGTFAYQNFVLGNMILTVAWRSEQSCRGFQFPSIQIHSLDR"
     MSKRKIEVYT QALSQLLLKS KQDFPDFRSF NHYKKQQIKS VRNRLIAEKL RLTSMELEFA        60
     KHEHGKPYLL NHTLHFNHSH SQQYYALALS ERIKDIGIDV EELDRKVRLD SLAQHAFHPD       120
     EYATWQSLEQ DREYWFKVWT TKEAVLKASG LGIRLDLNTL NTQAHPTNHG GLCSHELIGT       180
     FAYQNFVLGN MILTVAWRSE QSCRGFQFPS IQIHSLDR                               218
//

If you have problems or comments...

PBIL Back to PBIL home page