(data stored in ACNUC29543 zone)

EMBL: CP000521.PE509

CP000521.PE509       Location/Qualifiers
FT   CDS             complement(570218..570634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10983"
FT                   /protein_id="ABO10983.2"
FT                   /translation="MERWLEFMGNHPILFGTLGVLIVLFFIFEGQRNGRKISPQSLGIL
FT                   VKAKNALLIDLRDSKDFREGHISGSRNIPYSQIASHADELKASDRPLVFICNLGQVAGS
FT                   ALQKVAHHDSYRLDGGISNWKAQGLPLVKSKPKA"
     MERWLEFMGN HPILFGTLGV LIVLFFIFEG QRNGRKISPQ SLGILVKAKN ALLIDLRDSK        60
     DFREGHISGS RNIPYSQIAS HADELKASDR PLVFICNLGQ VAGSALQKVA HHDSYRLDGG       120
     ISNWKAQGLP LVKSKPKA                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page