(data stored in ACNUC29543 zone)

EMBL: CP000521.PE512

CP000521.PE512       Location/Qualifiers
FT   CDS             572637..573368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0533"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10986"
FT                   /protein_id="ABO10986.2"
FT                   /translation="MQSNNPILTRVETVSDYSQPMTVQGAIQKSVMLTIIAAAVGVALF
FT                   FYAAFTANVGIAYAASIVGAIGGLVLALITTFKPTTAPTLAIPYALFEGAFLGGISFTF
FT                   QLKYPGVPLQALLATFVTTLVMFGLYKFQIIRATEKFKSVVISASLAIFIVFIVQMVMR
FT                   LAFGSSIPYIFESNWLGIGFAAFVAVIASLNLILDFDLIETNAAYRAPKFMEWLCGIAL
FT                   LATLVWMYISFLRLLGLLSDD"
     MQSNNPILTR VETVSDYSQP MTVQGAIQKS VMLTIIAAAV GVALFFYAAF TANVGIAYAA        60
     SIVGAIGGLV LALITTFKPT TAPTLAIPYA LFEGAFLGGI SFTFQLKYPG VPLQALLATF       120
     VTTLVMFGLY KFQIIRATEK FKSVVISASL AIFIVFIVQM VMRLAFGSSI PYIFESNWLG       180
     IGFAAFVAVI ASLNLILDFD LIETNAAYRA PKFMEWLCGI ALLATLVWMY ISFLRLLGLL       240
     SDD                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page