(data stored in ACNUC29543 zone)

EMBL: CP000521.PE518

CP000521.PE518       Location/Qualifiers
FT   CDS             complement(579175..579267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3500"
FT                   /old_locus_tag="AS1_3500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89925"
FT                   /protein_id="ABS89925.1"
FT                   /translation="MWKNIIYTLGQPNHLPALLKYHKNSRFILI"
     MWKNIIYTLG QPNHLPALLK YHKNSRFILI                                         30
//

If you have problems or comments...

PBIL Back to PBIL home page