(data stored in ACNUC29543 zone)

EMBL: CP000521.PE52

CP000521.PE52        Location/Qualifiers
FT   CDS             complement(59233..59661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0050"
FT                   /product="putative protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10545"
FT                   /protein_id="ABO10545.2"
FT                   /translation="MQIKNILVVCIGNICRSPMAEYFLKQQYPQLNIESAGISGLIGHQ
FT                   ADEKAQLCMQRLGIDMQPHIARKLNAELIKKADLILVMSSNQQKHIEQTWPFAKGKTFR
FT                   LGHWQNKNVPDPYQHEQAVFDETCQLIQQCVADWKPYI"
     MQIKNILVVC IGNICRSPMA EYFLKQQYPQ LNIESAGISG LIGHQADEKA QLCMQRLGID        60
     MQPHIARKLN AELIKKADLI LVMSSNQQKH IEQTWPFAKG KTFRLGHWQN KNVPDPYQHE       120
     QAVFDETCQL IQQCVADWKP YI                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page