(data stored in ACNUC29543 zone)

EMBL: CP000521.PE525

CP000521.PE525       Location/Qualifiers
FT   CDS             586162..586653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0544"
FT                   /product="acetolactate synthase isozyme III small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10997"
FT                   /protein_id="ABO10997.2"
FT                   /translation="MRHIISVLVENEAGALSRLVGLFSQRNYNIETLNVAPTEDPTLSR
FT                   LTLTTYGDDHKIEQITKQLNKLVEVVKVVDLSEGSHIERELMLIKVKALGASRAEIKRT
FT                   ADIFRAQIVDVTPTTYTIQIAGTTEKLDGFIDALAENTILEVVRSGVSGIARGEKVLAI
FT                   "
     MRHIISVLVE NEAGALSRLV GLFSQRNYNI ETLNVAPTED PTLSRLTLTT YGDDHKIEQI        60
     TKQLNKLVEV VKVVDLSEGS HIERELMLIK VKALGASRAE IKRTADIFRA QIVDVTPTTY       120
     TIQIAGTTEK LDGFIDALAE NTILEVVRSG VSGIARGEKV LAI                         163
//

If you have problems or comments...

PBIL Back to PBIL home page