(data stored in ACNUC29543 zone)

EMBL: CP000521.PE532

CP000521.PE532       Location/Qualifiers
FT   CDS             593680..596445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0550"
FT                   /product="putative VGR-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11003"
FT                   /protein_id="ABO11003.2"
FT                   /translation="MYLQFSDASLNSQVFLQRIDGQHYLNQGMTAELICLSTNAHIPLK
FT                   TFIGLQVAVDQVTDRGSFFRTTGIITGASQGQSDGALTLYKLAISDPTYLWHKRRNSRV
FT                   FMNKSVKEISEILFQEWQGKSPLFASSLTLDLSGLKQTYDVRPFVMQLNESDYDFLTRL
FT                   WRSEGISWLIDEAELTVASNTDNIQPQKLRLIDDNSQYQTLTRRTIRYHRSSATEQFDS
FT                   MTSLIAGRHLQPSSVFVQRWQSDVLQQTDGAGSVQSKHEHSSNYDNQSLNLEDAWHFSP
FT                   AWMQDLNGEDGATSASNQQLEKFNQNLSAYHDAQSKQFVAQTTVRDTQVGYWFELNEHP
FT                   EIDLHSGADKEFLIIGKHYYNQNNLPKDLDQQIQTLTTQSHWQSSHTKERQGNQLILQR
FT                   RHIKTVPEYQPLQDRPQASVQRARVVGPEGESIYVDQWGRIKVRFLFTRANDHSHDGGA
FT                   GSNDNDTDSAWVDVLTPWAGAGYGARFLPRVGEIVVIDFFDGNIDRPFVVGRIHEAERH
FT                   PAQFDQKGQLPDTKKLSGIRSEEVDGKGFNQLRFDDTTGQISAQLQSSHAVSQLNLGNL
FT                   SHPKDKAESDGRGEGFELRTDQWGAVRAGKGLLVSTHKQDQAQGTHLDAADAKQQIEGG
FT                   LNNAKALSEVAKNQQTDPLEMLENLKTFIEQIEEKDQDKAATFKQALMVLTAPNSIAVA
FT                   SNEDIHLSADGQLSQNAGDSISLSTQKNLIAHAQNKISLFAAQQGARLYAGKGKVEIQA
FT                   QGDGADLIARKGIQIISTEDKIEINASKEIVITSGGSQIKINSSGIFPVTGGKFEVKAG
FT                   QHVFMGGAKADYVLPSLPTQEIKTDDLLLEYLHSDGTPVKGADYEVLLSDGSIRKGKLD
FT                   ASGKAIVSGVPAGRAKIQYGEDQSKDEFPALEVDDWFTQLGSSTKTGKEE"
     MYLQFSDASL NSQVFLQRID GQHYLNQGMT AELICLSTNA HIPLKTFIGL QVAVDQVTDR        60
     GSFFRTTGII TGASQGQSDG ALTLYKLAIS DPTYLWHKRR NSRVFMNKSV KEISEILFQE       120
     WQGKSPLFAS SLTLDLSGLK QTYDVRPFVM QLNESDYDFL TRLWRSEGIS WLIDEAELTV       180
     ASNTDNIQPQ KLRLIDDNSQ YQTLTRRTIR YHRSSATEQF DSMTSLIAGR HLQPSSVFVQ       240
     RWQSDVLQQT DGAGSVQSKH EHSSNYDNQS LNLEDAWHFS PAWMQDLNGE DGATSASNQQ       300
     LEKFNQNLSA YHDAQSKQFV AQTTVRDTQV GYWFELNEHP EIDLHSGADK EFLIIGKHYY       360
     NQNNLPKDLD QQIQTLTTQS HWQSSHTKER QGNQLILQRR HIKTVPEYQP LQDRPQASVQ       420
     RARVVGPEGE SIYVDQWGRI KVRFLFTRAN DHSHDGGAGS NDNDTDSAWV DVLTPWAGAG       480
     YGARFLPRVG EIVVIDFFDG NIDRPFVVGR IHEAERHPAQ FDQKGQLPDT KKLSGIRSEE       540
     VDGKGFNQLR FDDTTGQISA QLQSSHAVSQ LNLGNLSHPK DKAESDGRGE GFELRTDQWG       600
     AVRAGKGLLV STHKQDQAQG THLDAADAKQ QIEGGLNNAK ALSEVAKNQQ TDPLEMLENL       660
     KTFIEQIEEK DQDKAATFKQ ALMVLTAPNS IAVASNEDIH LSADGQLSQN AGDSISLSTQ       720
     KNLIAHAQNK ISLFAAQQGA RLYAGKGKVE IQAQGDGADL IARKGIQIIS TEDKIEINAS       780
     KEIVITSGGS QIKINSSGIF PVTGGKFEVK AGQHVFMGGA KADYVLPSLP TQEIKTDDLL       840
     LEYLHSDGTP VKGADYEVLL SDGSIRKGKL DASGKAIVSG VPAGRAKIQY GEDQSKDEFP       900
     ALEVDDWFTQ LGSSTKTGKE E                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page