(data stored in ACNUC29543 zone)

EMBL: CP000521.PE533

CP000521.PE533       Location/Qualifiers
FT   CDS             596452..598041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11004"
FT                   /protein_id="ABO11004.2"
FT                   /translation="MPDPQNQQFWSKIAERPTEIQQQFWYGAEKLAKYLNDNPAMYKGY
FT                   MTYDTSKPDPNLSWWEKILFYSGQAHYNEAVTHYNTSKVIADQGSWLWGMLKGDFNKDP
FT                   SMSQIIVGGLISLIPVADQVCDIRDLIANFITLSDEKARTKDNYMALALTSVGIIPEVG
FT                   SAIKTIVKSSRAKDVSKVKLFKFMEYFEEALTKLKIKCPWGKAPEAWLRSRPWKGIATQ
FT                   AFNTLKNNIDRILSVINKCLIRFNGALKVALAKFQATLNHVLNTIKKYIDQLCDEVDKA
FT                   IGRLLPQQPLAMAHAGGGGKNAPTGRYEANVSSGKKTEASHRQKKETPPPPRKMKPKHV
FT                   VEPCLEPKKGLRNSWGKKTGKSQAELDAEFDRQLKRQEEGLNRLTVEEYQQNRQLYEKY
FT                   KRAGTGTQQQRIREDMQRQLEESEYKKLKTEQPQLSKGQIERMAENNAKKTLEGLDVLH
FT                   NPDMQLGGFDVKYDPKKPPTLDDFGHSGVNRSIGSQMAAKKRLANMDAAAAQAKAKGMG
FT                   KDAMDVELKRCK"
     MPDPQNQQFW SKIAERPTEI QQQFWYGAEK LAKYLNDNPA MYKGYMTYDT SKPDPNLSWW        60
     EKILFYSGQA HYNEAVTHYN TSKVIADQGS WLWGMLKGDF NKDPSMSQII VGGLISLIPV       120
     ADQVCDIRDL IANFITLSDE KARTKDNYMA LALTSVGIIP EVGSAIKTIV KSSRAKDVSK       180
     VKLFKFMEYF EEALTKLKIK CPWGKAPEAW LRSRPWKGIA TQAFNTLKNN IDRILSVINK       240
     CLIRFNGALK VALAKFQATL NHVLNTIKKY IDQLCDEVDK AIGRLLPQQP LAMAHAGGGG       300
     KNAPTGRYEA NVSSGKKTEA SHRQKKETPP PPRKMKPKHV VEPCLEPKKG LRNSWGKKTG       360
     KSQAELDAEF DRQLKRQEEG LNRLTVEEYQ QNRQLYEKYK RAGTGTQQQR IREDMQRQLE       420
     ESEYKKLKTE QPQLSKGQIE RMAENNAKKT LEGLDVLHNP DMQLGGFDVK YDPKKPPTLD       480
     DFGHSGVNRS IGSQMAAKKR LANMDAAAAQ AKAKGMGKDA MDVELKRCK                   529
//

If you have problems or comments...

PBIL Back to PBIL home page